PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.001G239000.1
Common NameB456_001G239000, LOC105766233
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 305aa    MW: 34688 Da    PI: 7.8396
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.001G239000.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding582.2e-181461148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +g+WT+eEd++lv +++q+G+g+W++++ + g+ R+ k+c++rw +yl
  Gorai.001G239000.1 14 KGPWTPEEDLILVSYIQQHGPGNWRAVPTKTGLLRCSKSCRLRWANYL 61
                        79******************************99************97 PP

2Myb_DNA-binding47.73.6e-1567112148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                         rg++T+ E++ ++++ ++lG++ W++Ia++++  Rt++++k++w+++l
  Gorai.001G239000.1  67 RGNFTENEEKMIIHLQALLGNR-WAAIASYLP-ERTDNDIKNYWNTHL 112
                         89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.2E-24564IPR009057Homeodomain-like
PROSITE profilePS5129423.903965IPR017930Myb domain
SuperFamilySSF466892.57E-3011108IPR009057Homeodomain-like
SMARTSM007173.5E-141363IPR001005SANT/Myb domain
PfamPF002491.4E-161461IPR001005SANT/Myb domain
CDDcd001672.07E-101661No hitNo description
Gene3DG3DSA:1.10.10.604.9E-2465116IPR009057Homeodomain-like
SMARTSM007171.2E-1466114IPR001005SANT/Myb domain
PROSITE profilePS5129419.4866116IPR017930Myb domain
PfamPF002492.6E-1467112IPR001005SANT/Myb domain
CDDcd001674.40E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001666Biological Processresponse to hypoxia
GO:0009617Biological Processresponse to bacterium
GO:0009626Biological Processplant-type hypersensitive response
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0042761Biological Processvery long-chain fatty acid biosynthetic process
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 305 aa     Download sequence    Send to blast
MGRQPCCDKV GVKKGPWTPE EDLILVSYIQ QHGPGNWRAV PTKTGLLRCS KSCRLRWANY  60
LRPGIRRGNF TENEEKMIIH LQALLGNRWA AIASYLPERT DNDIKNYWNT HLKKKLQGNE  120
SSSRYGFPSS SSSYQICRGQ WERKLQTDIH MAKKDLSDAL SPEKSSDLVE MKPFNNHTSS  180
PKPSGYASST ENIAKLLKGW MRNNPWKMAD SADYSEEGTV PMKEDKNSKE MAEAFQSHLG  240
FESLDSSLSD ISPSMSPETS LSQYESKPHL NAQSQLSLLE KWLFDEGKDY QLCDITLDQN  300
LYFF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A6e-26141164105MYB PROTO-ONCOGENE PROTEIN
1mse_C7e-26141164105C-Myb DNA-Binding Domain
1msf_C7e-26141164105C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00386DAPTransfer from AT3G28910Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ1182430.0DQ118243.1 Gossypium hirsutum myb transcription factor MYB30 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012441068.10.0PREDICTED: myb-related protein 306
SwissprotQ9SCU71e-111MYB30_ARATH; Transcription factor MYB30
TrEMBLA0A0D2PW310.0A0A0D2PW31_G
STRINGPOPTR_0004s12530.11e-129(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM58422348
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28910.11e-108myb domain protein 30
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]